General Information

  • ID:  hor000584
  • Uniprot ID:  P85797
  • Protein name:  Allatostatin-7b
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVHYSGGQPLGS
  • Length:  12(158-169)
  • Propeptide:  MRSRTSVLTSSLAFLYFFGIVGRSALAMEETPASSMNLQHYNNMLNPMVFDDTMPEKRAYTYVSEYKRLPVYNFGIGKRWIDTNDNKRGRDYSFGLGKRRQYSFGLGKRNDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEEKRGRQPYSFGLGKRAVHYSGGQPLGSKRPNDMLSQRYHFGLGKRMSEDEEESSQ
  • Signal peptide:  MRSRTSVLTSSLAFLYFFGIVGRSALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85797-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000584_AF2.pdbhor000584_ESM.pdb

Physical Information

Mass: 136865 Formula: C51H77N15O17
Absent amino acids: CDEFIKMNRTW Common amino acids: G
pI: 7.54 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -21.67 Boman Index: -355
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65
Instability Index: 7211.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain